DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ncam1 and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:360 Identity:89/360 - (24%)
Similarity:140/360 - (38%) Gaps:52/360 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    98 VTAEDGTQSEA------TVNVKIFQKLMF----KNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWK 152
            ::.:.|::..|      |:|..|.:...|    :|...|    .|.:..:.|.|.:.....:.|.
  Fly    26 LSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVP----AGRNVKLACSVKNLGSYKVAWM 86

Mouse   153 HKGRDVILKKDVRFIVLSNN----------------YLQIRGIKKTDEGTYRCE-GRILARGEIN 200
            |..:..||  .|...|::.|                :|.|..:::.|.|.|.|: ..:.|:.:..
  Fly    87 HFEQSAIL--TVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYG 149

Mouse   201 FKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTK-DGEPIENEEEDDEKH 264
            |    |.|.|||.:....:..:.....|.:|||.|.|.|.||||:.|.: ||..|. ..:..|.|
  Fly   150 F----VKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIV-INKTLEVH 209

Mouse   265 IFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQ-DASIHLKVFAKPKITYVENQTAMELEEQVTL 328
            ....||.||  ..:.:.....|:|||.|..... ...|.:.|...|.:........:.:...:||
  Fly   210 DLETDSLEL--ERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITL 272

Mouse   329 TCEASGDPIPSITW-RTSTRNISSEEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAG 392
            .|....:|.....| |.:.:.|:...|      .|.||:.||   .|:.....||:.::|.:|.|
  Fly   273 ECFIEANPTSLNYWTRENDQMITESSK------YKTETIPGH---PSYKATMRLTITNVQSSDYG 328

Mouse   393 EYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYT 427
            .|.|.|.|..|....::.|.:...|..|.|....|
  Fly   329 NYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTT 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273 4/22 (18%)
IG 124..190 CDD:214652 16/81 (20%)
Ig3_NCAM-1_like 211..308 CDD:143207 30/98 (31%)
Ig_NCAM-1 307..413 CDD:143277 26/106 (25%)
Ig_3 417..494 CDD:372822 4/11 (36%)
FN3 509..606 CDD:238020
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/105 (21%)
Ig 69..139 CDD:143165 15/71 (21%)
IG_like 165..249 CDD:214653 27/86 (31%)
IGc2 172..237 CDD:197706 26/67 (39%)
IG_like 267..348 CDD:214653 24/89 (27%)
Ig 270..339 CDD:299845 23/77 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.