DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ncam1 and DIP-zeta

DIOPT Version :9

Sequence 1:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:423 Identity:100/423 - (23%)
Similarity:161/423 - (38%) Gaps:90/423 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   122 NAPTPQ--------EFKE---------GEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVL 169
            |.||..        ||.|         |.:..:.|.|.:.....:.|.|..:..||  .|...|:
  Fly   100 NVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAIL--TVHNHVI 162

Mouse   170 SNN----------------YLQIRGIKKTDEGTYRCE-GRILARGEINFKDIQVIVNVPPTVQAR 217
            :.|                ||.|..:.:.|.|.|.|: ..:.|:.:..:.::.|..|:..::.:.
  Fly   163 TRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSS 227

Mouse   218 QSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEE-EDDEKHIFSD-DSSELTIRNVDK 280
            ..||...||    ::|.|.|.|.|.|.:.|.:|    :|.. ..::.||.:: :...|.|..:.:
  Fly   228 DVIVREGAN----ISLRCRASGSPRPIIKWKRD----DNSRIAINKNHIVNEWEGDTLEITRISR 284

Mouse   281 NDEAEYVCIAENKAGEQDASIHLKVFAK-PKITYVENQTAMELEE-QVTLTCEASGDPIPSITWR 343
            .|...|:|||.|.. ....|..:||... |.:..:.:|.....|. .||:.|.....| .|:.: 
  Fly   285 LDMGAYLCIASNGV-PPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHP-TSLNY- 346

Mouse   344 TSTRNISSEEKASWTRPE----------KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTA 398
                         |||.|          |.|...|....::|.:   ||:.::...|.|.|.|.|
  Fly   347 -------------WTRGEGPIIHDSHKYKVEATVGLPAYKTHMK---LTIINVSSGDDGIYKCVA 395

Mouse   399 SNTIGQDSQSMYLEVQYAPKLQGPVAVYT----WEGNQVNITCEVFAY--PSATIS-WFRDGQLL 456
            .|..|:....:.|.|.|.|..... .:|:    |..|.:|   ..:||  |.:|.| :.:|....
  Fly   396 KNPRGETDGIIRLYVSYPPTTASS-GIYSTDTHWGENGIN---NNYAYGGPDSTRSIYAQDKNTR 456

Mouse   457 PSSNYSNIKIYNTPSASYLEVTPDSENDFGNYN 489
            ..||.:.|.:  :...|:|:.|.:.....||.|
  Fly   457 YQSNLNEIGL--SEQKSFLDKTQNPLLANGNAN 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 21/98 (21%)
Ig3_NCAM-1_like 211..308 CDD:143207 26/98 (27%)
Ig_NCAM-1 307..413 CDD:143277 26/117 (22%)
Ig_3 417..494 CDD:372822 20/80 (25%)
FN3 509..606 CDD:238020
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 18/97 (19%)
Ig 130..200 CDD:143165 16/71 (23%)
I-set 226..310 CDD:254352 26/92 (28%)
IGc2 233..298 CDD:197706 21/72 (29%)
Ig 313..410 CDD:299845 26/114 (23%)
IG_like 325..410 CDD:214653 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.