DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naip6 and Diap2

DIOPT Version :9

Sequence 1:NP_035001.2 Gene:Naip6 / 17952 MGIID:1298222 Length:1403 Species:Mus musculus
Sequence 2:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster


Alignment Length:465 Identity:119/465 - (25%)
Similarity:188/465 - (40%) Gaps:106/465 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    57 MRSEAKRLKTFESYDTFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLIL----FGNSLRKLPIERH 117
            |..|:.||.||..:......:.:::.|.||:.||..|..:|..|.:.:    :|:.:    .|||
  Fly     6 MELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQV----AERH 66

Mouse   118 KKLRPECEF-LQGKDVGNI-------GKYDIRVKSPEK------MLRGGKARYHEEEARLESFED 168
            ::..|.|.. |.....||:       .:.:..|.|||.      :|         |..||.:|:|
  Fly    67 RRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVDSPESCSCPDLLL---------EANRLVTFKD 122

Mouse   169 WPFYAHGTSPRALSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSS 233
            ||  ....:|:||:.|||.:..:.|.|:|..|.|.:..||:.|:.::||.::||:|..:|.....
  Fly   123 WP--NPNITPQALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLI 185

Mouse   234 EEIAQYIQDYEGFVHVTGEHFVKSWVR-RELPMVSAY-CNDSVFTNEELRMDMFKDWPQESPVGF 296
            |             ..||::..:..:: ..||:...| |.|:       |:..|.|||..:....
  Fly   186 E-------------FATGKNLDELGIQPTTLPLRPKYACVDA-------RLRTFTDWPISNIQPA 230

Mouse   297 EALVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSA---EVI--- 355
            .||.:||.:|....|.||||.|...|..|.:.|:|..:|.|:.|:|.|:...|..|   ||:   
  Fly   231 SALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATT 295

Mouse   356 -------------PTLQSQYALPEATETTRESNHDDAAAVHSTVVDLGRSEAQWFQEARSLSEQL 407
                         ||||:...:.||......:...|...|.:.:.....|....|.   :|.|.|
  Fly   296 AANASSQPATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFS---TLDELL 357

Mouse   408 RDTYTKT---SFCHMNLP--------EVCSSLGTDHLLGCDVSIISKHVSQPVQGALTIP----- 456
            .|.:...   :...:..|        |.|.            :..||..|.|:..|.:||     
  Fly   358 HDIFDDAGAGAALEVREPPEPSAPFIEPCQ------------ATTSKAASVPIPVADSIPAKPQA 410

Mouse   457 -EVFSNLSSV 465
             |..:|:|.:
  Fly   411 AEAVANISKI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naip6NP_035001.2 BIR 1 60..127 19/71 (27%)
BIR 61..129 CDD:237989 19/72 (26%)
BIR 2 159..227 26/67 (39%)
BIR 162..228 CDD:279047 25/65 (38%)
BIR 277..346 CDD:197595 25/68 (37%)
BIR 3 278..345 24/66 (36%)
NACHT 464..618 CDD:283404 0/2 (0%)
AMN1 1072..1271 CDD:187754
leucine-rich repeat 1132..1156 CDD:275381
leucine-rich repeat 1157..1182 CDD:275381
leucine-rich repeat 1183..1207 CDD:275381
leucine-rich repeat 1208..1233 CDD:275381
leucine-rich repeat 1234..1264 CDD:275381
leucine-rich repeat 1265..1293 CDD:275381
leucine-rich repeat 1294..1322 CDD:275381
Diap2NP_477127.1 BIR 12..78 CDD:237989 18/69 (26%)
BIR 112..181 CDD:197595 27/79 (34%)
BIR 213..281 CDD:237989 26/74 (35%)
UBA_IAPs 320..363 CDD:270506 9/45 (20%)
zf-C3HC4_3 447..492 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.