DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naip5 and Diap2

DIOPT Version :9

Sequence 1:NP_035000.2 Gene:Naip5 / 17951 MGIID:1298220 Length:1403 Species:Mus musculus
Sequence 2:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster


Alignment Length:456 Identity:116/456 - (25%)
Similarity:186/456 - (40%) Gaps:88/456 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    57 MRSEAKRLKTFETYDTFRSWTPQEMAAAGFYHTGVRLGVQCFCCSLIL----FGNSLRKLPIERH 117
            |..|:.||.||..:......:.:::.|.||:.||..|..:|..|.:.:    :|:.:    .|||
  Fly     6 MELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQV----AERH 66

Mouse   118 KKLRPECEF-LQGKDVGNIGKYDIRVKRPEKMLRGGKARYHEEEA-----------RLESFEDWP 170
            ::..|.|.. |.....||       |.|.::....|.:.....|:           ||.:|:|||
  Fly    67 RRSSPICSMVLAPNHCGN-------VPRSQESDNEGNSVVDSPESCSCPDLLLEANRLVTFKDWP 124

Mouse   171 FYAHGTSPRVLSAAGFVFTGKRDTVQCFSCGGSLGNWEEGDDPWKEHAKWFPKCEFLQSKKSSEE 235
              ....:|:.|:.|||.:..:.|.|:|..|.|.:..||:.|:.::||.::||:|..:|.....| 
  Fly   125 --NPNITPQALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIE- 186

Mouse   236 IAQYIQSYEGFVHVTGEHFVKSWVR-RELPMVSAY-CNDSVFANEELRMDMFKDWPQESPVGVEA 298
                        ..||::..:..:: ..||:...| |.|:       |:..|.|||..:.....|
  Fly   187 ------------FATGKNLDELGIQPTTLPLRPKYACVDA-------RLRTFTDWPISNIQPASA 232

Mouse   299 LVRAGFFYTGKKDIVRCFSCGGCLEKWAEGDDPMEDHIKFFPECVFLQTLKSSA---EVI----- 355
            |.:||.:|....|.||||.|...|..|.:.|:|..:|.|:.|:|.|:...|..|   ||:     
  Fly   233 LAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAA 297

Mouse   356 -----------PTLQSQYALPEATETTRESNHGDAAAVHSTVVDLGRSEAQWFQEARSLSEQLRD 409
                       ||||:...:.||......:...|...|.:.:.....|....|.   :|.|.|.|
  Fly   298 NASSQPATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFS---TLDELLHD 359

Mouse   410 NY----TKATFRHMNLPEVCSSLGTDHLLSCDVSIISKHISQPVQEALTIP------EVFSNLNS 464
            .:    ..|.......||..:..    :..|..: .||..|.|:..|.:||      |..:|::.
  Fly   360 IFDDAGAGAALEVREPPEPSAPF----IEPCQAT-TSKAASVPIPVADSIPAKPQAAEAVANISK 419

Mouse   465 V 465
            :
  Fly   420 I 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naip5NP_035000.2 BIR 1 60..127 19/71 (27%)
BIR 61..129 CDD:237989 19/72 (26%)
BIR 2 159..227 25/78 (32%)
BIR 162..228 CDD:366227 24/65 (37%)
BIR 3 278..345 24/66 (36%)
BIR 279..346 CDD:237989 25/66 (38%)
NACHT 464..618 CDD:368582 0/2 (0%)
NOD2_WH 688..743 CDD:375327
NLRC4_HD 767..873 CDD:375406
leucine-rich repeat 1055..1078 CDD:275380
AMN1 1072..1271 CDD:187754
leucine-rich repeat 1079..1100 CDD:275380
leucine-rich repeat 1104..1130 CDD:275380
leucine-rich repeat 1132..1156 CDD:275381
leucine-rich repeat 1157..1182 CDD:275381
leucine-rich repeat 1183..1207 CDD:275381
leucine-rich repeat 1208..1236 CDD:275381
leucine-rich repeat 1265..1293 CDD:275381
leucine-rich repeat 1294..1322 CDD:275381
Diap2NP_477127.1 BIR 12..78 CDD:237989 18/69 (26%)
BIR 112..181 CDD:197595 24/70 (34%)
BIR 213..281 CDD:237989 26/74 (35%)
UBA_IAPs 320..363 CDD:270506 9/45 (20%)
zf-C3HC4_3 447..492 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.