DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naip2 and Diap2

DIOPT Version :9

Sequence 1:NP_001119654.1 Gene:Naip2 / 17948 MGIID:1298226 Length:1447 Species:Mus musculus
Sequence 2:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster


Alignment Length:520 Identity:131/520 - (25%)
Similarity:210/520 - (40%) Gaps:87/520 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    57 MRSEAKRLKTFETYDKFRSWTPQEMAAAGFYHTGVKLGVQCFCCSLILFSTRLRKLPIENHKKLR 121
            |..|:.||.||..:......:.:::.|.||:.||..|..:|..|.:.:..........|.|::..
  Fly     6 MELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSS 70

Mouse   122 PECEFLLGKD-VGNI-------GKYDIRVKSPEKMLRGDKARYHEEEARLESFEDWPFYAHGTSP 178
            |.|..:|..: .||:       .:.:..|.|||.....|...   |..||.:|:|||  ....:|
  Fly    71 PICSMVLAPNHCGNVPRSQESDNEGNSVVDSPESCSCPDLLL---EANRLVTFKDWP--NPNITP 130

Mouse   179 RVLSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLQSKKSPEEITQYVQSY 243
            :.|:.|||.:..:.|.|:|..|.|.:..||:.|:.::||.::||:|..:|.....|         
  Fly   131 QALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIE--------- 186

Mouse   244 EGFLHVTGEHFVNSWVR-RELPMVSAY-CNDSVFANEELRMDTFKDWPHESPGAVEALVKAGLFY 306
                ..||::.....:: ..||:...| |.|:       |:.||.|||..:.....||.:|||:|
  Fly   187 ----FATGKNLDELGIQPTTLPLRPKYACVDA-------RLRTFTDWPISNIQPASALAQAGLYY 240

Mouse   307 TGKRDIVQCFSCGGCMEKWAEGDNPIEDHTKFFPNCVFLQTLKSSAEVIPALQSHCALPEAMETT 371
            ....|.|:||.|...:..|.:.|.|..:|.|:.|.|.|:...|..|.|...|.:         |.
  Fly   241 QKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLAT---------TA 296

Mouse   372 SESNHDDAAAVHSTV-VDVSPSEAQELEPASSLVSV-----LCRDQDHSEAQGRGCASSGTYLPS 430
            :.::...|.|...|: .||...||    ||...:::     :.|:....:....|||.      |
  Fly   297 ANASSQPATAPAPTLQADVLMDEA----PAKEALALGIDGGVVRNAIQRKLLSSGCAF------S 351

Mouse   431 T----------DLGQSEAQWLQEARSLSEQLRDTYTKATFRHMNLP-EVYSSLGTDHLLSCDVSI 484
            |          |.|...|..::|....|....:.....|.:..::| .|..|:......:..|:.
  Fly   352 TLDELLHDIFDDAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPVADSIPAKPQAAEAVAN 416

Mouse   485 ISKHISQPVQ--------GSLTIPEVFSNLNSV----MCVEGEAGSGKTTFLKRIAFLWASGCCP 537
            ||| |:..:|        |:|::.|....|...    :|::.|.|   ..||........:.|.|
  Fly   417 ISK-ITDEIQKMSVATPNGNLSLEEENRQLKDARLCKVCLDEEVG---VVFLPCGHLATCNQCAP 477

Mouse   538  537
              Fly   478  477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naip2NP_001119654.1 BIR 1 60..127 17/66 (26%)
BIR 61..129 CDD:237989 16/67 (24%)
BIR 159..229 CDD:197595 25/69 (36%)
BIR 2 159..227 25/67 (37%)
BIR 277..346 CDD:197595 25/68 (37%)
BIR 3 278..345 24/66 (36%)
AAA 507..644 CDD:214640 7/35 (20%)
NACHT 508..662 CDD:283404 7/34 (21%)
LRR_RI 1106..1373 CDD:238064
leucine-rich repeat 1201..1226 CDD:275381
leucine-rich repeat 1227..1251 CDD:275381
leucine-rich repeat 1252..1280 CDD:275381
leucine-rich repeat 1281..1305 CDD:275381
leucine-rich repeat 1306..1337 CDD:275381
leucine-rich repeat 1338..1366 CDD:275381
leucine-rich repeat 1367..1399 CDD:275381
Diap2NP_477127.1 BIR 12..78 CDD:237989 16/65 (25%)
BIR 112..181 CDD:197595 25/73 (34%)
BIR 213..281 CDD:237989 26/74 (35%)
UBA_IAPs 320..363 CDD:270506 9/52 (17%)
zf-C3HC4_3 447..492 CDD:290631 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.