DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment his-35 and His2A:CG33829

DIOPT Version :9

Sequence 1:NP_505463.1 Gene:his-35 / 179339 WormBaseID:WBGene00001909 Length:127 Species:Caenorhabditis elegans
Sequence 2:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster


Alignment Length:122 Identity:111/122 - (90%)
Similarity:118/122 - (96%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MSGRGKGGKAKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVL 65
            |||||||||.|  |||||||:||||||||||:||:|||||||:|||||||||||||:||||||||
  Fly     1 MSGRGKGGKVK--GKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63

 Worm    66 ELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKT 122
            |||||||||||||||.|||||||:||||||||||:||||||||||||||||||||||
  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
his-35NP_505463.1 PTZ00017 18..127 CDD:185399 97/105 (92%)
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 97/105 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I2850
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I2296
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm4829
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2143
SonicParanoid 1 1.000 - - X55
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.