DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment his-51 and His2A:CG33823

DIOPT Version :9

Sequence 1:NP_505277.1 Gene:his-51 / 179261 WormBaseID:WBGene00001925 Length:127 Species:Caenorhabditis elegans
Sequence 2:NP_001027316.1 Gene:His2A:CG33823 / 3771783 FlyBaseID:FBgn0053823 Length:124 Species:Drosophila melanogaster


Alignment Length:122 Identity:111/122 - (90%)
Similarity:118/122 - (96%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MSGRGKGGKAKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVL 65
            |||||||||.|  |||||||:||||||||||:||:|||||||:|||||||||||||:||||||||
  Fly     1 MSGRGKGGKVK--GKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63

 Worm    66 ELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKT 122
            |||||||||||||||.|||||||:||||||||||:||||||||||||||||||||||
  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
his-51NP_505277.1 PTZ00017 18..127 CDD:185399 97/105 (92%)
His2A:CG33823NP_001027316.1 PTZ00017 16..124 CDD:185399 97/105 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100077
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.