DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myl2 and sqh

DIOPT Version :9

Sequence 1:NP_001371255.1 Gene:Myl2 / 17906 MGIID:97272 Length:166 Species:Mus musculus
Sequence 2:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster


Alignment Length:161 Identity:84/161 - (52%)
Similarity:114/161 - (70%) Gaps:3/161 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 KKRIEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIK 71
            |||.:..:||||:||:|.||.||||||.::|||||||::|.||.|..|:||: |..::.:|.|:.
  Fly    14 KKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK-NPTDDYLDGMMN 77

Mouse    72 EAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEID 136
            |||||||||:|||:|||:|:|.|||:.|.|||..||.|..|.|..|.:||:|||..:||:.|::|
  Fly    78 EAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVD 142

Mouse   137 QMFAAFPPDVTGNLDYKNLVHIITHG-EEKD 166
            :|:.. .|...|..||.....|:.|| ::||
  Fly   143 EMYRE-APIKNGLFDYLEFTRILKHGAKDKD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myl2NP_001371255.1 FRQ1 14..163 CDD:227455 79/149 (53%)
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 81/156 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I6572
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.