DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myl7 and sqh

DIOPT Version :9

Sequence 1:NP_075017.2 Gene:Myl7 / 17898 MGIID:107495 Length:175 Species:Mus musculus
Sequence 2:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster


Alignment Length:177 Identity:85/177 - (48%)
Similarity:120/177 - (67%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MASRKAGTRGKAAAT-KQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLKETYSQL 64
            |:|||  |.|:.|.| |:|||.:||||:||:||||.||||||:.|||||||.:.|.||.:..:.|
  Fly     1 MSSRK--TAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASL 63

Mouse    65 GRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQ 129
            |: :..::.||.|:.|..||||||:|||||||:|.|||||:.|.:||..||....||:.::..::
  Fly    64 GK-NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRE 127

Mouse   130 LLMTQADKFSPAEVEQLFALTPMDLAGNIDYKSLCYIITHG-DEKEE 175
            ||.|..|:|:..:|::::...|:. .|..||.....|:.|| .:|:|
  Fly   128 LLTTMGDRFTDEDVDEMYREAPIK-NGLFDYLEFTRILKHGAKDKDE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myl7NP_075017.2 FRQ1 22..169 CDD:227455 69/146 (47%)
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 75/156 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.