DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pqn-51 and stnB

DIOPT Version :9

Sequence 1:NP_001379665.1 Gene:pqn-51 / 178893 WormBaseID:WBGene00004136 Length:354 Species:Caenorhabditis elegans
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:341 Identity:70/341 - (20%)
Similarity:123/341 - (36%) Gaps:126/341 - (36%)


- Green bases have known domain annotations that are detailed below.


 Worm     5 NGIAELYKSVMADVIANMKEAFLDENIDVDVLSQLRKEWEDKVNSSGCVDLES--NAPPPAPRQQ 67
            :|:|:|     .||..:...:...:.|:.|::|.:          :|.|.|::  ..|...|..|
  Fly   173 SGLADL-----LDVSVDSGSSAHTQGIEADLISGV----------AGGVRLDNPFAVPTAVPNIQ 222

 Worm    68 HHV--------------PPSAVRPNPMPPQRPVAQQPVRALSALH---AAHIGDAPIRMAYTG-- 113
            ..|              ||....|.|.||.:...|:|...|:|::   ||...|..:.|..|.  
  Fly   223 AAVPLPATPIKQPPRPPPPRPAPPRPAPPGQAAPQRPPPPLAAVNPPPAAPEADDLLDMFGTTAC 287

 Worm   114 QPTQHPSQVRMFNPQFQGGIHFQPGQVFVVQQPNGQNIPMSIMPNQIPQHRIIH--------QGQ 170
            :|.:.|.      |:.:..|      :.:.:||   ::|:| .|...|.  ::|        :|:
  Fly   288 KPAKPPP------PKSKEDI------LSLFEQP---HVPLS-QPASKPD--LLHDDLDETIGEGE 334

 Worm   171 PQQAQQQQPQQGNQL------------------TH--MNQMDGNVGSE---SDGEGPSGPVKLAP 212
            |.:.::...:|.|::                  ||  .:|.....|.|   ::...|||.     
  Fly   335 PPEQEEPDTEQSNEISSRDEPVFTSLLIRPDESTHDITSQPQAATGLERQVNNMAAPSGT----- 394

 Worm   213 KKTKCSLRVRGSGASEKKAMKVLGSLLKDFQLDGGGGGMSDSSSEDEP--DDDDDPLRRIADRMG 275
                         ||.::|      ...|.::         ::.||.|  ||:|:|     :.|.
  Fly   395 -------------ASTQRA------TTPDIEI---------TTVEDLPRSDDEDEP-----EAMQ 426

 Worm   276 NGEVEDGDQV-AEEEP 290
            ..|.|...|: .:.||
  Fly   427 EPETETKPQIEPDTEP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pqn-51NP_001379665.1 TFIIA 10..354 CDD:397322 68/336 (20%)
TFIIA_alpha_beta_like <308..354 CDD:199899
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603 22/104 (21%)
AP_MHD_Cterm 897..1219 CDD:299401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.