DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myf6 and nau

DIOPT Version :9

Sequence 1:NP_032683.1 Gene:Myf6 / 17878 MGIID:97253 Length:242 Species:Mus musculus
Sequence 2:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster


Alignment Length:227 Identity:94/227 - (41%)
Similarity:121/227 - (53%) Gaps:27/227 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 PLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRK 88
            |:|:  ..||  |.:.|.||.......:..|..|.|||||||...........||.||||.||:|
  Fly    96 PVEL--DKPL--GMNMTPSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKK 156

Mouse    89 SAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQ 153
            |...|||||||:||||||:|:|||||.|||||.:|||||||||||||:||.|||.|:|||.....
  Fly   157 SVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLLQESST 221

Mouse   154 QEKMQELGVDPYSYKPKQEILEGADFLRTCSPQW--PSVSDHSRGL----VITAKEGGANVDASA 212
            ......| ....|.|..|     :|:|.:.:..:  ..:|.:::.:    ..|..:|.||     
  Fly   222 TRDGDNL-APSLSGKSCQ-----SDYLSSYAGAYLEDKLSFYNKHMEKYGQFTDFDGNAN----- 275

Mouse   213 SSSLQRLSSIVDSISS------EERKLPSVEE 238
            .|||..|:.||.||:.      :.:..||..:
  Fly   276 GSSLDCLNLIVQSINKSTTSPIQNKATPSASD 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myf6NP_032683.1 Basic 3..93 CDD:279868 27/68 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..63 11/31 (35%)
HLH 94..145 CDD:278439 41/50 (82%)
nauNP_476650.1 Basic 89..166 CDD:299793 31/73 (42%)
HLH 162..213 CDD:278439 41/50 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849410
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6254
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 1 1.000 - - otm57817
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.