DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myf5 and nau

DIOPT Version :9

Sequence 1:NP_032682.1 Gene:Myf5 / 17877 MGIID:97252 Length:255 Species:Mus musculus
Sequence 2:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster


Alignment Length:219 Identity:97/219 - (44%)
Similarity:118/219 - (53%) Gaps:47/219 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    52 EEHVRAP---TGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTN 113
            ||||.||   :....:..||.|||||||:||.|:||||||||||||||:|||:|||.|||.|::|
  Fly   127 EEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSN 191

Mouse   114 PNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRK 178
            |||||||||||||||.|||||::||:|                 |.|:...|.:    :|..|.|
  Fly   192 PNQRLPKVEILRNAIEYIESLEDLLQE-----------------SSTTRDGDNL----APSLSGK 235

Mouse   179 NSSFDSIYCPDVSNACAADKSSV--------------------SSLDCLSSIVDRITSTEPSELA 223
            :...|  |....:.|...||.|.                    ||||||:.||..|..:..|.:.
  Fly   236 SCQSD--YLSSYAGAYLEDKLSFYNKHMEKYGQFTDFDGNANGSSLDCLNLIVQSINKSTTSPIQ 298

Mouse   224 LQDTASLSPATSANSQPATPGPSS 247
            .:.|.|.|...|..|..|| .|:|
  Fly   299 NKATPSASDTQSPPSSGAT-APTS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Myf5NP_032682.1 BASIC 1..88 CDD:128794 22/38 (58%)
bHLH_TS_Myf5 83..146 CDD:381507 48/62 (77%)
Myf5 143..214 CDD:371979 20/90 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..249 9/22 (41%)
nauNP_476650.1 Basic 89..166 CDD:299793 22/38 (58%)
HLH 162..213 CDD:278439 43/50 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849413
Domainoid 1 1.000 90 1.000 Domainoid score I7750
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4436
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 1 1.000 - - otm43012
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.880

Return to query results.
Submit another query.