DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-3 and Dcp-1

DIOPT Version :9

Sequence 1:NP_001255708.1 Gene:ced-3 / 178272 WormBaseID:WBGene00000417 Length:503 Species:Caenorhabditis elegans
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:291 Identity:87/291 - (29%)
Similarity:126/291 - (43%) Gaps:50/291 - (17%)


- Green bases have known domain annotations that are detailed below.


 Worm   219 FVDAPTISRVFDEKTMYRNFSSPRGMCLIINNEHFE--QMPTRNGTKADKDNLTNLFRCMGYTV- 280
            ||....:.|...|   |......||:.||.|:|.|:  .:.:|.||..|...|...|..:|:.| 
  Fly    58 FVARMPVERYASE---YNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVS 119

 Worm   281 ICKDNLTGRGMLLTIRDFAKH--------ESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDL 337
            :.||        ..:||..||        .:..|...:.||||||...:. ..|.......|:..
  Fly   120 VHKD--------CKLRDILKHVGKAAELDHTDNDCLAVAILSHGEHGYLY-AKDTQYKLDNIWHY 175

 Worm   338 LNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQV 402
            ..|...|.||.|||:.|:|||:|:|.|.|..           |.:|....||.            
  Fly   176 FTATFCPSLAGKPKLFFIQACQGDRLDGGIT-----------LEKGVTETDGE------------ 217

 Worm   403 QQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVAC 467
            .....|.|..||.|.:|:|...|.||||...|||::|::....:.:.|..|::.|||.||::||.
  Fly   218 SSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVAL 282

 Worm   468 GFQTSQGSNIL----KQMPEMTSRLLKKFYF 494
            .|:::..:..:    ||:|.:||.|.:...|
  Fly   283 DFESNVPATPMMDRQKQIPCLTSMLTRILRF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-3NP_001255708.1 CARD 2..90 CDD:128424
CASc 235..496 CDD:214521 83/275 (30%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 82/273 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162598
Domainoid 1 1.000 130 1.000 Domainoid score I3239
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I3180
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm4766
orthoMCL 1 0.900 - - OOG6_103710
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3066
SonicParanoid 1 1.000 - - X460
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.