DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ced-3 and Damm

DIOPT Version :9

Sequence 1:NP_001255708.1 Gene:ced-3 / 178272 WormBaseID:WBGene00000417 Length:503 Species:Caenorhabditis elegans
Sequence 2:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster


Alignment Length:301 Identity:73/301 - (24%)
Similarity:112/301 - (37%) Gaps:81/301 - (26%)


- Green bases have known domain annotations that are detailed below.


 Worm   225 ISRVFDEKTMYRNFSSPRGMCL----------IINNEHFEQ--MPTRNGTKADKDNLTNLFRCMG 277
            |.|::|...:  |....:|:.|          |:|:|.|.|  ...|.|:..|.:.|...|.   
  Fly    12 IERLYDSNRV--NAEPGQGLDLNEKLKPPAVYILNHEQFPQDSQLNRKGSSNDVNALRKTFE--- 71

 Worm   278 YTVICKDNLTGRGMLLTIRD-----FAKHESHGDSAILVILSHGE-ENVIIGVDDIPISTHEIYD 336
             ::.|:..:.....|..:::     .||..:.....:|.|||||: :..|:..|      |..|.
  Fly    72 -SLKCRVEVISNPALPDVKNKVKEWSAKRFTQDAGFVLFILSHGDRKEKILACD------HREYH 129

 Worm   337 -----LLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLG 396
                 |......|.|:.||||:.||||:|..|.:.                              
  Fly   130 LDDDVLFPLFRNPTLSGKPKILIVQACKGPLRADA------------------------------ 164

 Worm   397 CVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEV 461
                       ||.:....:..|:.:..|:|:||...||.|||.:||....:....|...:...|
  Fly   165 -----------KKMNNEPYIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHV 218

 Worm   462 NKKVACGFQTSQGSNILKQMP-EMTSRLLKKFYFWPEARNS 501
            ..:|. ...|..||   ||:| |.:....|.|||...|:|:
  Fly   219 KAEVE-RRSTMTGS---KQVPSEESHNFDKPFYFGNYAKNT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ced-3NP_001255708.1 CARD 2..90 CDD:128424
CASc 235..496 CDD:214521 68/284 (24%)
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 63/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.