DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rbm-34 and eIF4B

DIOPT Version :9

Sequence 1:NP_502291.1 Gene:rbm-34 / 178148 WormBaseID:WBGene00008688 Length:394 Species:Caenorhabditis elegans
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:139 Identity:29/139 - (20%)
Similarity:61/139 - (43%) Gaps:22/139 - (15%)


- Green bases have known domain annotations that are detailed below.


 Worm   249 FVGNLPFEITEDALITFFSAQIGPVEAVRIV------RDKDTGKGKGFAFVNFKQDSSVSLALSM 307
            ::.||||:..||.|..||       |.:.::      .|.:.|:.:||.:|..:....:...||:
  Fly    83 YINNLPFDANEDDLYEFF-------EGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSL 140

 Worm   308 ETIKMEKRDLRITKVMKKGHLTKIQTAKKRTSHGKKNQNEITGKLHK--------FKFSTKKERT 364
            ....::.|.:||....:....::.::.::....|....|..:|...:        |.:|:..||:
  Fly   141 PDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWRRDSQNNGSNFGYSSNFERS 205

 Worm   365 TEQNDRRAL 373
            ..: :|::|
  Fly   206 FNR-ERKSL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rbm-34NP_502291.1 RRM1_RBM34 144..233 CDD:240840
RRM2_RBM34 247..320 CDD:240841 19/76 (25%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 29/139 (21%)
RRM_eIF4B 79..155 CDD:240848 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.