DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rib-1 and sotv

DIOPT Version :9

Sequence 1:NP_502180.1 Gene:rib-1 / 178080 WormBaseID:WBGene00004360 Length:382 Species:Caenorhabditis elegans
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:362 Identity:96/362 - (26%)
Similarity:180/362 - (49%) Gaps:34/362 - (9%)


- Green bases have known domain annotations that are detailed below.


 Worm    22 NPTIERK----QCTMSNCFDFSKCSTSK-KVYIHPMEKRFEESPQ------SVIYSKILKHFLES 75
            ||..|::    .||..:|.:..||...: ||||:|:::..:|...      |..|.:||:..|:|
  Fly    80 NPEAEQRARNVNCTFWDCLNIYKCEHDRLKVYIYPLQEFVDEQSDKTATTLSSEYFQILEAVLKS 144

 Worm    76 NHYTNDPNEACIFLLGIDTTDRDVRSQNYVKNVNDYIESLDPSVWNNGRNHLIFNFYHGTFPDYD 140
            .:||::|||||:||..:|..:::|..::.   ....:.|||  .|:.|.||:|||...|..|.|:
  Fly   145 RYYTSNPNEACLFLPSLDLLNQNVFDKHL---AGAALASLD--FWDRGANHIIFNMLPGGAPSYN 204

 Worm   141 DHNLNFDTGEAMIARASSSENNFIKVFDVSLPLFHENHPYEIKESKSERNDDRIENQRKYLVSFK 205
            . .|:.:|..|:|........::...|||::|::         ..:..|.......|||:|:...
  Fly   205 T-VLDVNTDNAIIFGGGFDSWSYRPGFDVAIPVW---------SPRLVRQHAHATAQRKFLLVVA 259

 Worm   206 GKRYVYGIGSGTRNLVHHLHNGDDIVMVTTCKHNNDWQVYQDDRCQRDNDEYDRWEYDELLANST 270
            ....:.......|.|  .|.:.:.::::..|: |.|..:    ||.. :..:...||..||:...
  Fly   260 QLNILPRFVRTLREL--SLAHSEQLLLLGACE-NLDLTM----RCPL-SQHHKSLEYPRLLSRGK 316

 Worm   271 FCLVPRGRRLGSFRFLETLRSGCVPVVISDSWILPFSETIDWNSAAIVVAERDALSIPELLMSTS 335
            |||:.|..|:|....:|.:...|:||:..|:::|||.:.|||:.|::.:.|.:..|:.:.|.:.|
  Fly   317 FCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLKAIS 381

 Worm   336 RRRVKELRESARNVYDAYLRSIQVISDHVLRIIFKRI 372
            ..::.|:::..:.::..|.:.::.::...|.::..||
  Fly   382 SVKIVEMQKQVQWLFSKYFKDLKTVTLTALEVLESRI 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rib-1NP_502180.1 Exostosin 46..333 CDD:308581 82/292 (28%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 82/297 (28%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D314330at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.