DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment his-57 and His2A:CG33832

DIOPT Version :9

Sequence 1:NP_001263787.1 Gene:his-57 / 178056 WormBaseID:WBGene00001931 Length:147 Species:Caenorhabditis elegans
Sequence 2:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster


Alignment Length:122 Identity:111/122 - (90%)
Similarity:118/122 - (96%) Gaps:2/122 - (1%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MSGRGKGGKAKTGGKAKSRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVL 65
            |||||||||.|  |||||||:||||||||||:||:|||||||:|||||||||||||:||||||||
  Fly     1 MSGRGKGGKVK--GKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63

 Worm    66 ELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKKT 122
            |||||||||||||||.|||||||:||||||||||:||||||||||||||||||||||
  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
his-57NP_001263787.1 H2A 18..123 CDD:197711 97/105 (92%)
H2A 18..121 CDD:238029 94/102 (92%)
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399 97/105 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100077
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2143
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.