Sequence 1: | NP_032662.3 | Gene: | Mtf1 / 17764 | MGIID: | 101786 | Length: | 675 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651878.1 | Gene: | CG1792 / 43727 | FlyBaseID: | FBgn0039860 | Length: | 372 | Species: | Drosophila melanogaster |
Alignment Length: | 269 | Identity: | 80/269 - (29%) |
---|---|---|---|
Similarity: | 119/269 - (44%) | Gaps: | 41/269 - (15%) |
- Green bases have known domain annotations that are detailed below.
Mouse 79 EGFLIDQEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETK----RKEVKRY 139
Mouse 140 QCTFEGCPRTYST---AGNLRTHQ--------------KTHRGEYTFVCNQEGCGKAFLTSYSLR 187
Mouse 188 IHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKT-FNCESQGCSKYFTTLSDLRKHIR- 250
Mouse 251 THTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTFSTQYSLKSH--MKGHD 313
Mouse 314 NKGTAYSAL 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mtf1 | NP_032662.3 | COG5048 | <92..308 | CDD:227381 | 68/238 (29%) |
Nuclear localization signal. /evidence=ECO:0000255 | 132..137 | 2/8 (25%) | |||
C2H2 Zn finger | 141..163 | CDD:275368 | 5/38 (13%) | ||
zf-H2C2_2 | 155..182 | CDD:290200 | 8/40 (20%) | ||
C2H2 Zn finger | 171..193 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 185..212 | CDD:290200 | 9/26 (35%) | ||
C2H2 Zn finger | 201..223 | CDD:275368 | 8/21 (38%) | ||
C2H2 Zn finger | 235..252 | CDD:275368 | 4/17 (24%) | ||
zf-H2C2_2 | 244..270 | CDD:290200 | 10/26 (38%) | ||
C2H2 Zn finger | 260..282 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 274..301 | CDD:290200 | 12/26 (46%) | ||
C2H2 Zn finger | 290..312 | CDD:275368 | 8/23 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 427..464 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 645..675 | ||||
CG1792 | NP_651878.1 | zf-AD | 6..80 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 226..243 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 254..275 | CDD:275368 | 5/22 (23%) | ||
zf-C2H2 | 281..303 | CDD:278523 | 10/23 (43%) | ||
C2H2 Zn finger | 283..303 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 296..320 | CDD:290200 | 12/25 (48%) | ||
C2H2 Zn finger | 311..329 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |