DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-19 and CG34031

DIOPT Version :9

Sequence 1:NP_001023142.1 Gene:ceh-19 / 177590 WormBaseID:WBGene00000442 Length:199 Species:Caenorhabditis elegans
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:220 Identity:72/220 - (32%)
Similarity:102/220 - (46%) Gaps:69/220 - (31%)


- Green bases have known domain annotations that are detailed below.


 Worm     2 AFNIESLLEKKSNPVEEGNDFEEENDSEKNGEEDEEEEEKNVIDGWTNMATSQLA-----MFAIA 61
            ||:|:|:|..           .|.:.|:.:..:|.           ||:.:|.::     .|...
  Fly    30 AFSIDSILST-----------SEAHSSQNSLPKDN-----------TNVTSSDISKLYAFSFTQE 72

 Worm    62 NDLRTPTLVELQMLLG-----------------------------VSARKHDYKRSRKSVCERKP 97
            .:.:|| |....:..|                             .::.....|:.||...:|||
  Fly    73 GNNKTP-LTNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQLRKRFTDRKP 136

 Worm    98 RQAYSARQLDRLETEFQTDKYLSVNKRIQLSQTLNLTETQIKTWFQNRRTKWKKQLTSSIRQMVK 162
            ||||||.||:|||.||..||||||:||::||::|:|||.|:|||||||||||||||||.::...:
  Fly   137 RQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHR 201

 Worm   163 DAPTSTSVGVPFQSLLTPPTPPTTL 187
                        ..|..|..|.||:
  Fly   202 ------------HGLWIPTLPITTI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-19NP_001023142.1 Homeobox 97..150 CDD:278475 39/52 (75%)
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166896
Domainoid 1 1.000 98 1.000 Domainoid score I4516
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - oto19741
orthoMCL 1 0.900 - - OOG6_121437
Panther 1 1.100 - - LDO PTHR24333
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13790
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.