| Sequence 1: | NP_001023313.1 | Gene: | M03D4.4 / 177375 | WormBaseID: | WBGene00019751 | Length: | 505 | Species: | Caenorhabditis elegans |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_731558.1 | Gene: | CG31441 / 326139 | FlyBaseID: | FBgn0051441 | Length: | 341 | Species: | Drosophila melanogaster |
| Alignment Length: | 196 | Identity: | 46/196 - (23%) |
|---|---|---|---|
| Similarity: | 89/196 - (45%) | Gaps: | 3/196 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Worm 25 REEHETVEQGDQEEDRMEDDSDELAMIKIKIEDSDFLSDT--DSSQLSMNPTTPSEKSSSGEKGR 87
Worm 88 YECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWMWHTGERSHVCPHCNKA 152
Worm 153 FFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKIH-QERGFSCQQCGRSFLKQVMLDE 216
Worm 217 H 217 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| M03D4.4 | NP_001023313.1 | C2H2 Zn finger | 90..110 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 102..127 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 118..138 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 146..166 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 158..181 | CDD:290200 | 7/22 (32%) | ||
| zf-C2H2 | 172..194 | CDD:278523 | 5/21 (24%) | ||
| C2H2 Zn finger | 174..194 | CDD:275368 | 5/19 (26%) | ||
| CG31441 | NP_731558.1 | zf-AD | 7..82 | CDD:285071 | |
| COG5048 | <174..337 | CDD:227381 | 39/152 (26%) | ||
| C2H2 Zn finger | 197..217 | CDD:275370 | 5/19 (26%) | ||
| C2H2 Zn finger | 225..245 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 253..273 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 268..290 | CDD:290200 | 8/21 (38%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 309..328 | CDD:275368 | 6/17 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||