DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Msx2 and btn

DIOPT Version :10

Sequence 1:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:96 Identity:38/96 - (39%)
Similarity:53/96 - (55%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse   109 SEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERA 173
            :|....|:|..   :|..:.:......||...:|||.||.|:.:||..||.:|....||:...|.
  Fly    56 NEANDQWLQNE---APTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRY 117

Mouse   174 EFSSSLNLTETQVKIWFQNRRAKAKRLQEAE 204
            |.:.:|.|||.|||:||||||.|.||::..|
  Fly   118 EIAVALELTERQVKVWFQNRRMKCKRIKLEE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 4/22 (18%)
Homeodomain 143..199 CDD:459649 28/55 (51%)
btnNP_732768.1 Homeodomain 87..143 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.