DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Msx2 and slou

DIOPT Version :10

Sequence 1:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus
Sequence 2:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster


Alignment Length:132 Identity:51/132 - (38%)
Similarity:68/132 - (51%) Gaps:29/132 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse   143 RKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEK 207
            |:.||.||..||::||.||:..:|||:.||...:.||:||||||||||||||.|.|: |...:: 
  Fly   546 RRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKK-QNPGMD- 608

Mouse   208 LKMAAKPMLPSGFSLPFPINSPL---QAASIYG----ASYPFHRPVLPIPPVGLYATPVGYGMYH 265
                              :|||.   .....:|    ||...:...:|.||.|.|..|:  |.:|
  Fly   609 ------------------VNSPTIPPPGGGSFGPGAYASGLLYSHAVPYPPYGPYFHPL--GAHH 653

Mouse   266 LS 267
            ||
  Fly   654 LS 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132
Homeodomain 143..199 CDD:459649 33/55 (60%)
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 33/55 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.