DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Msx2 and zen

DIOPT Version :10

Sequence 1:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:57 Identity:28/57 - (49%)
Similarity:37/57 - (64%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse   143 RKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKR 199
            ::.||.||:.||:.||.:|:...||....|.|.:..|:|.|.||||||||||.|.|:
  Fly    91 KRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132
Homeodomain 143..199 CDD:459649 27/55 (49%)
zenNP_476793.1 Homeodomain 91..147 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.