DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Msx2 and zen2

DIOPT Version :10

Sequence 1:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:67 Identity:33/67 - (49%)
Similarity:44/67 - (65%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse   133 TCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKA 197
            |.|.|..:.:::.||.|::.||:.|||:|...:||:...|.|.|..|.|||.||||||||||.|.
  Fly    34 TATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKL 98

Mouse   198 KR 199
            |:
  Fly    99 KK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132
Homeodomain 143..199 CDD:459649 29/55 (53%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.