DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Msx2 and vnd

DIOPT Version :10

Sequence 1:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus
Sequence 2:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster


Alignment Length:143 Identity:49/143 - (34%)
Similarity:57/143 - (39%) Gaps:46/143 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse   108 NSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAER 172
            |..||.|                         ...||.|..||.:|...|||:|||::|||..||
  Fly   536 NGSDGLP-------------------------NKKRKRRVLFTKAQTYELERRFRQQRYLSAPER 575

Mouse   173 AEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYG 237
            ...:|.:.||.|||||||||.|.|.||.|.   || .....|.|..|.                 
  Fly   576 EHLASLIRLTPTQVKIWFQNHRYKTKRAQN---EK-GYEGHPGLLHGH----------------- 619

Mouse   238 ASYPFHRPVLPIP 250
            |::|.|...||.|
  Fly   620 ATHPHHPSALPSP 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 4/23 (17%)
Homeodomain 143..199 CDD:459649 31/55 (56%)
vndNP_476786.2 Homeodomain 546..602 CDD:459649 31/55 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.