DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sik1 and CG9222

DIOPT Version :9

Sequence 1:NP_034961.2 Gene:Sik1 / 17691 MGIID:104754 Length:779 Species:Mus musculus
Sequence 2:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster


Alignment Length:285 Identity:104/285 - (36%)
Similarity:160/285 - (56%) Gaps:22/285 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 PSGT----GQGQQKPLRVGFYD----VERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSN 67
            |||.    ...:.||.:....:    :.:.:|.||:|.||:........:||:|||.|.:..|..
  Fly    52 PSGVVPVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEY 116

Mouse    68 LEK-IYREVQLMKLLNHPNIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARQKFW 131
            .:| :.||::.:|.|:|.|:|..||.:||...:|::.:.|:||.:.||:.....|.|.::|..|.
  Fly   117 TQKFLPREIEAVKGLHHENLITFYQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFK 181

Mouse   132 QILSAVEYCHNHHIVHRDLKTENLLLDSNMDIKLADFGFGNFYKPGEP------LS-TWCGSPPY 189
            |::|||||.|:..:||||:|.||||||.|.::||.||||..  |....      || |:|||..|
  Fly   182 QLVSAVEYIHSKGVVHRDIKCENLLLDENWNLKLIDFGFAR--KDTRTSDNQVILSKTFCGSYAY 244

Mouse   190 AAPEVFEGKEYEGPQLDVWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGR-FRIPFFMSQDCET 253
            |:||:.:|..|:....|:|:.|||.|.:|.|.||:||.|:..|.:|:.:.. |......|.:|:.
  Fly   245 ASPEILKGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKSPSASSECKH 309

Mouse   254 LIRRMLVVDPAK-RITIAQIRQHRW 277
            :|  |.::.|.| |..|.|:::..|
  Fly   310 MI--MHILAPVKIRYNIPQVKEDPW 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sik1NP_034961.2 STKc_SIK 26..278 CDD:270973 99/266 (37%)
S_TKc 27..278 CDD:214567 99/265 (37%)
UBA_SIK1 300..349 CDD:270591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..472
RK-rich region 586..612
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 621..641
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 99/262 (38%)
S_TKc 78..332 CDD:214567 98/257 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.