DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rpl-15 and RpL15

DIOPT Version :9

Sequence 1:NP_499964.1 Gene:rpl-15 / 176891 WormBaseID:WBGene00004427 Length:204 Species:Caenorhabditis elegans
Sequence 2:NP_001015155.1 Gene:RpL15 / 3354918 FlyBaseID:FBgn0028697 Length:204 Species:Drosophila melanogaster


Alignment Length:204 Identity:143/204 - (70%)
Similarity:171/204 - (83%) Gaps:0/204 - (0%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MGAYKYMQEIWRKKQSDALRYLLRIRTWHYRQLSAVHRVPRPTRPEKARRLGYRAKQGFVVYRVR 65
            ||||:||||::||||||.:|||||||.|.||||:.:||.||||||:||||||||||||||:||:|
  Fly     1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIR 65

 Worm    66 VRRGNRKRPVCKGQTYGKPKTHGVNELKNAKSKQAVAEGRAGRRLGSLRVLNSYWVAEDSTYKFY 130
            ||||.|||||.||.||||||:||||:||..:..|::||.|.|||||.||||||||:|:|::||::
  Fly    66 VRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYF 130

 Worm   131 EVVLIDPFHKAIRRNPDTQWITKPVHKHREQRGLTSAGRKSRGLGKGWRFSATRGGSQAKNWKRK 195
            ||:|||..|.||||:|...||.|.||||||.|||||||:.|||:|||:|:|.|.|||:...||||
  Fly   131 EVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRK 195

 Worm   196 NTKVFHRKR 204
            |.:..||||
  Fly   196 NREHMHRKR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rpl-15NP_499964.1 Ribosomal_L15e 2..191 CDD:279200 133/188 (71%)
RpL15NP_001015155.1 Ribosomal_L15e 2..191 CDD:395665 133/188 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162238
Domainoid 1 1.000 290 1.000 Domainoid score I837
eggNOG 1 0.900 - - E1_COG1632
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 310 1.000 Inparanoid score I1558
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62174
OrthoDB 1 1.010 - - D1181691at2759
OrthoFinder 1 1.000 - - FOG0002642
OrthoInspector 1 1.000 - - oto20553
orthoMCL 1 0.900 - - OOG6_100733
Panther 1 1.100 - - LDO PTHR11847
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1110
SonicParanoid 1 1.000 - - X1745
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.