DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Msc and Fer1

DIOPT Version :9

Sequence 1:XP_011236650.1 Gene:Msc / 17681 MGIID:1333884 Length:217 Species:Mus musculus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:144 Identity:48/144 - (33%)
Similarity:73/144 - (50%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    91 PPKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLR 155
            |.:...|.....||.|||.|||.||:.:::||..|:|.:|.:|.:.:|||:|||:||.|||..|.
  Fly    75 PRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLS 139

Mouse   156 QLLQEDR------------YEDSYVHPVNLV------GMLRS----RPGDSSPERYPGPGL-ARP 197
            :::::|:            |:..  .|..::      |:..|    |.||    ||||..| ||.
  Fly   140 EMVKKDKNGNEPGLSLQRNYQKE--PPKKIILKDRTGGVAHSLSWYRKGD----RYPGSKLYART 198

Mouse   198 QT-KSQEGRFLEPV 210
            .| :...|...:|:
  Fly   199 WTPEDPRGPHSQPL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MscXP_011236650.1 bHLH_TS_musculin 100..165 CDD:381546 30/76 (39%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.