DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acbp-5 and anox

DIOPT Version :9

Sequence 1:NP_499817.2 Gene:acbp-5 / 176800 WormBaseID:WBGene00011731 Length:274 Species:Caenorhabditis elegans
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:256 Identity:70/256 - (27%)
Similarity:114/256 - (44%) Gaps:36/256 - (14%)


- Green bases have known domain annotations that are detailed below.


 Worm    18 NQEEEPIDTLLEAKFDAATTRLPGFLTKIDQKTILKFYGLYKQAVEGPADSKKGPYWFETVARKK 82
            :.:.:.:|.|    |..||..:......|....:|.|||.||||..||. .::.|...:..|:.|
  Fly     3 DSDTDTVDEL----FHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPC-KEQSPGLLQLQAKSK 62

 Worm    83 FNSWLANSQMSRSRAMEAYCELMAQLDTSWDPDAETVKKSGLWEKMPSTMGVIEPEMFDDAVVH- 146
            :.:|.....||:|.|.:||.:.:.:|..:|     ..:::..|                  ||| 
  Fly    63 WQAWRNLGTMSQSAARQAYVQKLQELQPNW-----RSRRNPGW------------------VVHS 104

 Worm   147 ----PPTKLETETEKKWFAAMRVSDIDTMRTLLRNEPEIIEAKDQYLAMTALLWATDLGCDPVVQ 207
                |......::||..|..::.:::|.:|.||  :|..:...|:: .|..:.||||.....::|
  Fly   105 IESVPLEDQRLDSEKTLFDHVKENNLDRLRELL--QPSDLVKLDEH-GMALIHWATDRNAVEIIQ 166

 Worm   208 FLIENNVDVNAVDGCLQTALHFAAQCHRPLLAELLLQAGADRSALDADGLTPSECCDDEDL 268
            ||:.:...||..|...||.||:||.|......:.||:..|.....|:||.|..:..|||.:
  Fly   167 FLVRSGASVNQRDAEQQTPLHYAASCGHLEALQCLLELHASLELRDSDGQTCYDVADDEQI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acbp-5NP_499817.2 ACBP 29..108 CDD:279259 24/78 (31%)
Ank_2 160..253 CDD:289560 28/92 (30%)
ANK 161..272 CDD:238125 34/108 (31%)
ANK repeat 188..220 CDD:293786 10/31 (32%)
ANK repeat 222..253 CDD:293786 10/30 (33%)
anoxNP_001027085.1 ACBP 10..90 CDD:279259 27/84 (32%)
ANK 125..231 CDD:238125 34/106 (32%)
Ank_2 125..212 CDD:289560 27/89 (30%)
ANK repeat 148..179 CDD:293786 10/31 (32%)
ANK repeat 181..212 CDD:293786 10/30 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12465
Inparanoid 1 1.050 93 1.000 Inparanoid score I3655
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54934
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005754
OrthoInspector 1 1.000 - - oto19107
orthoMCL 1 0.900 - - OOG6_104190
Panther 1 1.100 - - LDO PTHR24119
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5885
SonicParanoid 1 1.000 - - X1917
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.