Sequence 1: | NP_499531.1 | Gene: | maa-1 / 176612 | WormBaseID: | WBGene00007680 | Length: | 266 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001027085.1 | Gene: | anox / 3771728 | FlyBaseID: | FBgn0064116 | Length: | 243 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 51/202 - (25%) |
---|---|---|---|
Similarity: | 82/202 - (40%) | Gaps: | 37/202 - (18%) |
- Green bases have known domain annotations that are detailed below.
Worm 28 LNFYALFKQATHGKCDLPKPSFYDIQGVYKWNAWNKLDNMTMDEAKQAYVDSIVQKIREVQKEYK 92
Worm 93 TEE---WMKGDTYELLAPKFEVLGVLEG---KDQAVEHPKKTENKETENETDNVETPNSSACILS 151
Worm 152 DNEYADAIDDEIQSRSS-----SFTEPHNSFNRRISRQSS---LKSSCHRLEK-----ELKVITE 203
Worm 204 SIDKLGK 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
maa-1 | NP_499531.1 | ACBP | 3..84 | CDD:376410 | 23/55 (42%) |
anox | NP_001027085.1 | ACBP | 10..90 | CDD:279259 | 25/60 (42%) |
ANK | 125..231 | CDD:238125 | 19/92 (21%) | ||
Ank_2 | 125..212 | CDD:289560 | 17/86 (20%) | ||
ANK repeat | 148..179 | CDD:293786 | 4/30 (13%) | ||
ANK repeat | 181..212 | CDD:293786 | 8/30 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG4281 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |