DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sbp-1 and Mitf

DIOPT Version :9

Sequence 1:NP_499472.1 Gene:sbp-1 / 176574 WormBaseID:WBGene00004735 Length:1113 Species:Caenorhabditis elegans
Sequence 2:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster


Alignment Length:446 Identity:84/446 - (18%)
Similarity:155/446 - (34%) Gaps:121/446 - (27%)


- Green bases have known domain annotations that are detailed below.


 Worm   154 PAMTPHQAASLFVNTNGIDQKNFTHAMLSPPHHTSMTPQPYTEAMEHINGY----------MSPY 208
            |:|.....:.:.:..|.....|..::.|.         :...:.:|..|.:          :.|.
  Fly   309 PSMWGSHTSEIKLANNSASTGNLQNSSLQ---------KGICDPLERTNRFGCDSAVSAKRIMPS 364

 Worm   209 DQAQ--GPSGPSYYSQHHQSP-------PPHHHHHHPMPKIHENPEQVASPSIEDAPETKPTHLV 264
            |.|.  .|.|.|:......:|       |..|....|     ||..:.|...:..|..:.     
  Fly   365 DDAMPISPFGGSFVRCDDINPIEPTVLRPNSHGAGEP-----ENAHRTAQLGLSKANSSL----- 419

 Worm   265 EPQSPKSPQNMKEELLRLLVNMSPSEVERLKNKKSG--ACSATNGPSRSKEKAAKIVIQETAEGD 327
              .|.:|...:...:             |:.:..|.  :.||...||.|.      |....:|.|
  Fly   420 --SSTRSSSGIVNSI-------------RISSTSSSLQSTSAPISPSVSS------VATSVSEPD 463

 Worm   328 EDEDD---EDSDSGETMSQGTTIIVRRPKT-------------ERRTAHNLIEKKYRCSINDRIQ 376
            :..||   .||.:.:........|.:.|:.             :::..||:||::.|.:|||||:
  Fly   464 DIFDDILQNDSFNFDKNFNSELSIKQEPQNLTDAEMNALAKDRQKKDNHNMIERRRRFNINDRIK 528

 Worm   377 QLKVLL-CGDEA--------KLSKSATLRRAIEHIEEVEHE-NQVLKHHVEQMRKTLQNNRLPYP 431
            :|..|| .|.:|        :.:|...|:.::::|:.::|| .::.::.:.|.:..|||.:|  .
  Fly   529 ELGTLLPKGSDAFYEVVRDIRPNKGTILKSSVDYIKCLKHEVTRLRQNELRQRQVELQNRKL--M 591

 Worm   432 EPIQYTEYSARS---------------PVES-----SPSPPRNERKRSRMSTTTPMKNGTRDGSS 476
            ..|:..|..|:|               |.:.     |.||..:..:||........|....||:.
  Fly   592 SRIKELEMQAKSHGILLSENHLTSLSAPTQPYLKSFSLSPTASRSRRSLFDQPVEKKIQVIDGAD 656

 Worm   477 KVTLFAMLLAVLIFNPIGLLAGSAIFSKAAAEAPIASPFEHGRVIDDPDGTSTRTL 532
                     ..:..|.:........::....:..::|   |..:...|...|::||
  Fly   657 ---------GNMGMNQVDEFMEDCKYAVQGGDPMLSS---HSHMQSAPQSPSSKTL 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sbp-1NP_499472.1 Atrophin-1 30..>272 CDD:367360 22/136 (16%)
bHLH_SF 351..423 CDD:381792 22/94 (23%)
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573 1/1 (100%)
HLH 505..570 CDD:238036 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.