DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and CG34367

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:202 Identity:56/202 - (27%)
Similarity:81/202 - (40%) Gaps:52/202 - (25%)


- Green bases have known domain annotations that are detailed below.


 Worm    12 HNYYQDWPTTHSYYPSVPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSSNS 76
            |:..::...|:|..|::         |.|.: ...|.|:::          :..|...:......
  Fly    92 HSQREEHVETYSLSPTL---------HKAAV-EPKPKNWLI----------SEDLDVDSQPEDPK 136

 Worm    77 SAELPT-GVT--ASQHNTYKWMHTKRSQRPAAPKKKVIDENGTN-------------------RT 119
            .:.||| .:|  ....||.|....|    |..|::.|..|...|                   ||
  Fly   137 MSGLPTASITECTEDSNTPKLAPDK----PLLPEECVSPEPSRNREHCDPLDTSLVNTKQRRSRT 197

 Worm   120 NFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKE--KAFLARN 182
            |||..||.|||:.|....|.:...|.|::..|.|.||:|::||||||.|.:|.|.:  |.||.  
  Fly   198 NFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKHENQMHKGFLV-- 260

 Worm   183 TWESNSP 189
              .|.||
  Fly   261 --GSRSP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 21/45 (47%)
CG34367NP_001097140.1 Homeobox 195..248 CDD:278475 26/52 (50%)
OAR 392..409 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.