DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and toy

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster


Alignment Length:176 Identity:46/176 - (26%)
Similarity:79/176 - (44%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


 Worm    43 WAAHPSNYIMGNGHVSPPATASGLSPPASRSSNS------SAELPTGVTASQHNTY------KWM 95
            ||.:|||  ....|::.|..||.::.||:.|..:      ..||...|..|..|::      ...
  Fly   184 WAWYPSN--TTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSE 246

 Worm    96 HTKRSQRPAAPKKKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKI 160
            |.......:..:.::..:...|||:|:..|:..|||||....|.:...|..:|..:.|.||::::
  Fly   247 HNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQV 311

 Worm   161 WFQNRRMKEKKREKEKAFL--------ARNTWESNSPTSSCSGEDV 198
            ||.|||.|.::.||.:...        :..|..:|:|:.:.:...|
  Fly   312 WFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 17/45 (38%)
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 28/105 (27%)
Homeobox 269..322 CDD:395001 21/52 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.