Sequence 1: | NP_498655.1 | Gene: | ceh-13 / 176069 | WormBaseID: | WBGene00000437 | Length: | 202 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
Alignment Length: | 216 | Identity: | 54/216 - (25%) |
---|---|---|---|
Similarity: | 82/216 - (37%) | Gaps: | 70/216 - (32%) |
- Green bases have known domain annotations that are detailed below.
Worm 16 QDWPTTH---SYYPS----VPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPATASGLSPP---- 69
Worm 70 ----------------------------ASRSSNSSAELPTGVTASQHNTYKWMHTKRSQRPAAP 106
Worm 107 KKKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKK 171
Worm 172 REKEKAFLARNTWESNSPTSS 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ceh-13 | NP_498655.1 | Homeobox | 118..164 | CDD:278475 | 18/45 (40%) |
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 22/51 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |