DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and ey

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:216 Identity:54/216 - (25%)
Similarity:82/216 - (37%) Gaps:70/216 - (32%)


- Green bases have known domain annotations that are detailed below.


 Worm    16 QDWPTTH---SYYPS----VPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPATASGLSPP---- 69
            |.||..|   |:||:    :|.|.:|              |......:.|.|:.|..||||    
  Fly   358 QSWPPRHYSGSWYPTSLSEIPISSAP--------------NIASVTAYASGPSLAHSLSPPNDIE 408

 Worm    70 ----------------------------ASRSSNSSAELPTGVTASQHNTYKWMHTKRSQRPAAP 106
                                        :..:.:...|...|..::..|      |:..|.....
  Fly   409 SLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGN------TEDDQARLIL 467

 Worm   107 KKKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKK 171
            |:|:    ..|||:||..|:..|||||....|.:...|..:|..:.|.||::::||.|||.|.::
  Fly   468 KRKL----QRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRR 528

 Worm   172 REKEKAFLARNTWESNSPTSS 192
            .||     .||  :..:|.|:
  Fly   529 EEK-----LRN--QRRTPNST 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 18/45 (40%)
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.