DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and ro

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:198 Identity:60/198 - (30%)
Similarity:93/198 - (46%) Gaps:37/198 - (18%)


- Green bases have known domain annotations that are detailed below.


 Worm    10 PPHNYY---QDWPTTHSYYPSVPSSYSPLNHHPADIWAAHPSNYIMGN-GHVSPP--ATASGLSP 68
            |.:::|   :|       ||..||.....:||...    ||...:... .:||||  ..|.|.:.
  Fly   103 PAYDFYGHAKD-------YPQHPSQQHQQHHHHHH----HPPQLVHQKLSYVSPPPAIAAGGAAN 156

 Worm    69 PASRSSNSSAELPTGVTASQHNT--YKWMHTKRSQRPAAPKKKVIDENGTNRTNFTTHQLTELEK 131
            |....:     .|.|..:..|.:  :.....:|.::....:::        ||.|:|.|...||.
  Fly   157 PVLPHA-----FPAGFPSDPHFSAGFSAFLARRRRKEGRQRRQ--------RTTFSTEQTLRLEV 208

 Worm   132 EFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREK---EKAFLARNTWESNSPTSSC 193
            |||..:|::|:||.|:|..|:|.|.|:||||||||.|:|:.||   ::.:  ||...:|...||.
  Fly   209 EFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQIDQHY--RNFVVANGFMSSI 271

 Worm   194 SGE 196
            .|:
  Fly   272 MGQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 24/45 (53%)
roNP_524521.1 Homeobox 196..247 CDD:278475 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.