DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and tin

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster


Alignment Length:254 Identity:63/254 - (24%)
Similarity:95/254 - (37%) Gaps:72/254 - (28%)


- Green bases have known domain annotations that are detailed below.


 Worm     7 YGAPPHNYYQDWPTTHSYYPSVPSSYSPLNHHPADIWAA-------HPSNY---IMGNGHVSPPA 61
            ||.|.|.:.......|..:....|:|   |...:..:|.       .|:.|   ..|:|.|...|
  Fly   132 YGMPAHMFQHHHGHPHQSFQHSASAY---NMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGA 193

 Worm    62 TASG------------LSPPASRSSNSSAEL-----PTG------------VTASQHNTYKWMH- 96
            |.|.            ::|..:...|||||:     ||.            .|||..::.:.:: 
  Fly   194 TPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYG 258

 Worm    97 -----TKRSQRPAAPKKKVIDEN--------GTN------------RTNFTTHQLTELEKEFHTA 136
                 .|:........:..:.:|        |:|            |..|:..|:.|||..|...
  Fly   259 SDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLK 323

 Worm   137 KYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKEKAFLARN----TWESNSPTS 191
            ||:....|..||..|.|...||||||||||.|.|:.:.:...:|::    :...:||||
  Fly   324 KYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 20/45 (44%)
tinNP_524433.1 HOX 301..357 CDD:197696 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.