DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and HHEX

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster


Alignment Length:203 Identity:52/203 - (25%)
Similarity:82/203 - (40%) Gaps:55/203 - (27%)


- Green bases have known domain annotations that are detailed below.


 Worm    29 PSS--YSPLNHHPADIW-------AAHPSNYIMGNGHVSPPATASGLSPPASRSSNSSAEL---- 80
            |:|  ::|:...||.::       ..:||.: |.:...:..|.|:.:.|.|.....|...:    
  Fly   101 PTSLRFNPIYPDPASLFYQQVLQLQKNPSLF-MPHFQAAAVAAAAAVQPTAYCDQYSPFTMDCEG 164

 Worm    81 ---PTGVTASQH-NTYKWMHTKRSQRPAAP--------KKKVIDENGTNRTNFTTHQLTELEKEF 133
               |....|:.: |.|          |||.        |:|      ..:..||:.|...||..|
  Fly   165 FPNPASAAAALYCNAY----------PAASFYMSNFGVKRK------GGQIRFTSQQTKNLEARF 213

 Worm   134 HTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKEKAFLARNTWESNSP--------T 190
            .::||::...|..:|..|||.:.|||.||||||.|.:     :|.|::.:..:..|        .
  Fly   214 ASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWR-----RANLSKRSASAQGPIAGAAVGSP 273

 Worm   191 SSCSGEDV 198
            ||.|...|
  Fly   274 SSASSSSV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 18/45 (40%)
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 23/49 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.