DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and abd-A

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster


Alignment Length:237 Identity:69/237 - (29%)
Similarity:94/237 - (39%) Gaps:79/237 - (33%)


- Green bases have known domain annotations that are detailed below.


 Worm    14 YYQDWPTTHS------------------YYPSVPSSYSPLNHHPADIWAAHPSNY---------- 50
            |..:.|::|.                  |..:|.:||..:: .||...|.....|          
  Fly   264 YVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMS-VPASASAQFAQFYQHATAAASAV 327

 Worm    51 -----------IMGNGHVSPPATASGLSPPASRSSNSS-AELPTGVTASQHNTYKWMHTKRSQRP 103
                       .:||....|   |||:.|.|..:..:. |:||         .|.||  ..:...
  Fly   328 SAASAGAIGVDSLGNACTQP---ASGVMPGAGGAGGAGIADLP---------RYPWM--TLTDWM 378

 Worm   104 AAPKKKVI--DENGTN-------RTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVK 159
            .:|.::|:  |.||.|       |..:|..|..|||||||...|:.|.||.|||..|.|.|.|:|
  Fly   379 GSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIK 443

 Worm   160 IWFQNRRMKEKK---------------REKEKAFLARNTWES 186
            |||||||||.||               ||:::...|:.|.:|
  Fly   444 IWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 25/45 (56%)
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 31/51 (61%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.