DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and NK7.1

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster


Alignment Length:165 Identity:54/165 - (32%)
Similarity:78/165 - (47%) Gaps:24/165 - (14%)


- Green bases have known domain annotations that are detailed below.


 Worm    39 PADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSSNSSAELPTGVTASQHNTYKWMHTKRSQRP 103
            |.||.....|:.:|.:..::..:::.|.:..|...||:::.|.|....|...:          ..
  Fly   335 PPDISPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGS----------TD 389

 Worm   104 AAPKKKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMK 168
            |..|||.       ||.||..|:.||||.|...||::.:.|||:|..|.:.|.||||||||||.|
  Fly   390 ARRKKKA-------RTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTK 447

 Worm   169 EKKREKEKAFLARNTWESN-------SPTSSCSGE 196
            .||::......|.....||       :.|::.|||
  Fly   448 WKKQDNVTNNEAAEHKSSNAKPGATGTATTTPSGE 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 24/45 (53%)
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.