DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and Antp

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:221 Identity:66/221 - (29%)
Similarity:91/221 - (41%) Gaps:57/221 - (25%)


- Green bases have known domain annotations that are detailed below.


 Worm     8 GAPP--------HNYYQDWPTTHSYYPSVPSSYSPL----------NHHPADIW--------AAH 46
            |:||        |...|.....|..:|.....|:.:          |||...::        ...
  Fly   178 GSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGA 242

 Worm    47 PSNYIMGNGHVSPPATASG----LSPPASRSSNSSAELPTGVTASQHNTYKWMHTKRSQRPAAPK 107
            |...:|..|. .||....|    .:||:...::.|:.:|:.:       |.||   |||.....:
  Fly   243 PPQGMMHQGQ-GPPQMHQGHPGQHTPPSQNPNSQSSGMPSPL-------YPWM---RSQFGKCQE 296

 Worm   108 KKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKR 172
            :|      ..|..:|.:|..|||||||..:|:.|.||.|||..|.|.|.|:||||||||||.||.
  Fly   297 RK------RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 355

 Worm   173 EKEKAFLARNTWESNSPTSSCSGEDV 198
            .|.|          ..|.|...|:::
  Fly   356 NKTK----------GEPGSGGEGDEI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 25/45 (56%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 29/144 (20%)
Homeobox 301..354 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.