DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and bcd

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:179 Identity:48/179 - (26%)
Similarity:77/179 - (43%) Gaps:30/179 - (16%)


- Green bases have known domain annotations that are detailed below.


 Worm    10 PPHNYYQDWPTTHSYYPSVPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSS 74
            |..|:|.. |..|::....|.|:...:.||      ||.       |..|....    ||..|:.
  Fly     6 PDQNFYHH-PLPHTHTHPHPHSHPHPHSHP------HPH-------HQHPQLQL----PPQFRNP 52

 Worm    75 -NSSAELPTGVTASQHNTYKWMHTKRSQRP------AAPKKKVIDENGTNRTNFTTHQLTELEKE 132
             :...:..||  |..:|..:.....:..:|      ..|...|:......||.||:.|:.|||:.
  Fly    53 FDLLFDERTG--AINYNYIRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAELEQH 115

 Worm   133 FHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEK---KREKEKAF 178
            |...:|:...|..::::.|.|..|||||||:|||.:.|   .:.|::::
  Fly   116 FLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQSY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 20/45 (44%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.