DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and pb

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:208 Identity:67/208 - (32%)
Similarity:93/208 - (44%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


 Worm    18 WPTTH--SYYPSVPSSYSPLNH-HPADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSSNSSAE 79
            |.|..  .:..|.||....||| .|.......|    :|:|.:      .|:....:.:......
  Fly    92 WMTASEGGFINSQPSMAEFLNHLSPESPKIGTP----VGSGAI------GGVGVNVNVNVGVGVG 146

 Worm    80 LPTGVTASQHN------TYKWMHTKRSQRPAAPKK--------KVIDENGTN---RTNFTTHQLT 127
            .|.||.....:      .|.||..|::.|.::...        :.:.|||..   ||.:|..||.
  Fly   147 YPVGVVPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLL 211

 Worm   128 ELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKR-------EKEKAFLARNTWE 185
            |||||||..||:.|.||.|||::|.|.|.|||:||||||||.|::       |..|..|..:..:
  Fly   212 ELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQ 276

 Worm   186 SNSPTS---SCSG 195
            |:|.::   ||.|
  Fly   277 SDSNSNSKKSCQG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 28/45 (62%)
pbNP_476669.3 COG5576 168..274 CDD:227863 44/105 (42%)
Homeobox 202..254 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.