DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and eyg

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_001014582.1 Gene:eyg / 39419 FlyBaseID:FBgn0000625 Length:670 Species:Drosophila melanogaster


Alignment Length:231 Identity:64/231 - (27%)
Similarity:92/231 - (39%) Gaps:73/231 - (31%)


- Green bases have known domain annotations that are detailed below.


 Worm    17 DWPTTHSY--YPSVPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPATASGL----------SPP 69
            ::..|.:|  ||..|        ||...:..||:..:.|...|.||...|.|          .||
  Fly   227 EFARTAAYGLYPPPP--------HPYGSFTWHPAGNVPGGQGVPPPPPPSALWSVAAPTLANLPP 283

 Worm    70 ASRS--------SNSSAEL--------PTGVTAS----QHNTYKWMHTKRSQRPAAPKKKVIDEN 114
            ::.|        |.|||.|        ||....|    .|:|.:          :|.:.:.||.:
  Fly   284 SAASAVPVSTCGSLSSAHLMAGGAGGTPTNRAISPGSGSHDTLE----------SADENRHIDSD 338

 Worm   115 ----------GTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKE 169
                      ..|||.|:..||.||||||..:.|...:.|..::|...|.||:|::||.|||.|.
  Fly   339 YLDDDDEPKFRRNRTTFSPEQLEELEKEFDKSHYPCVSTRERLSSRTSLSEARVQVWFSNRRAKW 403

 Worm   170 K--------KREKEKAFLARNTWESN-----SPTSS 192
            :        ||::.......::.:||     |||.|
  Fly   404 RRHQRMNLLKRQRSSPANPLHSQQSNDAPASSPTPS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 20/45 (44%)
eygNP_001014582.1 HTH 120..217 CDD:304362
Homeobox 352..404 CDD:278475 24/51 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.