DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and Dbx

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_647677.2 Gene:Dbx / 38254 FlyBaseID:FBgn0261723 Length:741 Species:Drosophila melanogaster


Alignment Length:196 Identity:51/196 - (26%)
Similarity:80/196 - (40%) Gaps:45/196 - (22%)


- Green bases have known domain annotations that are detailed below.


 Worm    10 PPHNYYQDWPTTHSYYPSVPSSYSP--LNHHPADIWAAHPSN-YIMGNGHVSPPATASGLSPPAS 71
            ||       |......||.|:.:.|  |||.......||..| |:.....|.|            
  Fly   369 PP-------PVIAKPMPSRPTPFLPHTLNHPHLHSLLAHCRNPYMSVGAQVFP------------ 414

 Worm    72 RSSNSSAELPTGVTASQHNTYKWMHTKRSQRPAAPKKKVIDENGTNRTNFTTHQLTELEKEFHTA 136
                    ||.|      ..:.|.|:.|.:    |::.::     .|..|:..|...|||.|...
  Fly   415 --------LPPG------QGFPWAHSTRGK----PRRGMM-----RRAVFSDSQRKGLEKRFQQQ 456

 Worm   137 KYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKEKAFLARNTWESNSPTSSCSGEDVKNF 201
            ||:::..|.::|..|.|:::||||||||||||.:..::.:...:..:.:...|..:....|:.:.
  Fly   457 KYISKPDRKKLAERLGLKDSQVKIWFQNRRMKWRNSKERELLASGGSRDQTLPNKNNPNPDLSDA 521

 Worm   202 K 202
            |
  Fly   522 K 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 19/45 (42%)
DbxNP_647677.2 Homeobox 437..490 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.