DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and en

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster


Alignment Length:200 Identity:61/200 - (30%)
Similarity:90/200 - (45%) Gaps:22/200 - (11%)


- Green bases have known domain annotations that are detailed below.


 Worm     2 SSTECYGAPPHNYYQDWPTTHSYYPSVPSS-------YSPLNHHPADIWAAHPSNYIMGNGHVSP 59
            |::.....||.:......:|.|...|..||       .|.||..|:....|..|.....:....|
  Fly   322 SASSLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQP 386

 Worm    60 PATASGLSPPASRSSNSSAELPTGVTASQHNTYK----WMH-TKRSQRPAA---------PKKKV 110
            ....|.:|..:...|:......||.|.::....:    |:: |:.|.||::         ||.|.
  Fly   387 IPPPSAVSRDSGMESSDDTRSETGSTTTEGGKNEMWPAWVYCTRYSDRPSSGPRYRRPKQPKDKT 451

 Worm   111 IDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKE 175
            .||. ..||.|::.||..|::||:..:|:...||.:::|.|.|.|||:||||||:|.|.||....
  Fly   452 NDEK-RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGS 515

 Worm   176 KAFLA 180
            |..||
  Fly   516 KNPLA 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 21/45 (47%)
enNP_523700.2 Homeobox 457..510 CDD:278475 25/52 (48%)
Engrail_1_C_sig 512..541 CDD:287495 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.