DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and eve

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:151 Identity:50/151 - (33%)
Similarity:69/151 - (45%) Gaps:35/151 - (23%)


- Green bases have known domain annotations that are detailed below.


 Worm    22 HSYYPSVPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSSNSSAELPTGVTA 86
            |:::.:.|....||   ..|:.|..     .|.....||:....||.| ..|.|.|         
  Fly    13 HAHHDASPVDQKPL---VVDLLATQ-----YGKPQTPPPSPNECLSSP-DNSLNGS--------- 59

 Worm    87 SQHNTYKWMHTKRSQRPAAPKKKVIDENGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNL 151
                       :.|:.||.|..:      ..||.||..||..|||||:...||:|.||.|:|:.|
  Fly    60 -----------RGSEIPADPSVR------RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQL 107

 Worm   152 KLQEAQVKIWFQNRRMKEKKR 172
            .|.|:.:|:||||||||:|::
  Fly   108 NLPESTIKVWFQNRRMKDKRQ 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 24/45 (53%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.