Sequence 1: | NP_498655.1 | Gene: | ceh-13 / 176069 | WormBaseID: | WBGene00000437 | Length: | 202 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
Alignment Length: | 270 | Identity: | 72/270 - (26%) |
---|---|---|---|
Similarity: | 92/270 - (34%) | Gaps: | 97/270 - (35%) |
- Green bases have known domain annotations that are detailed below.
Worm 10 PPHNYYQDWPTTHSYYPSVP--------SSYSPLN------------------------------ 36
Worm 37 ----HHPADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSSNSSAE--LPTG------------ 83
Worm 84 ----VTASQHNTYKWMHTKR------------SQRPAAPKK--------KVIDENGTN------- 117
Worm 118 -RTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKEKAFLAR 181
Worm 182 NTWESNSPTS 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ceh-13 | NP_498655.1 | Homeobox | 118..164 | CDD:278475 | 28/45 (62%) |
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 32/50 (64%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |