DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and unpg

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:270 Identity:72/270 - (26%)
Similarity:92/270 - (34%) Gaps:97/270 - (35%)


- Green bases have known domain annotations that are detailed below.


 Worm    10 PPHNYYQDWPTTHSYYPSVP--------SSYSPLN------------------------------ 36
            |||      |.||:....:|        :.:.|.|                              
  Fly   133 PPH------PPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSV 191

 Worm    37 ----HHPADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSSNSSAE--LPTG------------ 83
                .|.|.....|......|...:..|......|.||...|:|..|  |..|            
  Fly   192 HARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSC 256

 Worm    84 ----VTASQHNTYKWMHTKR------------SQRPAAPKK--------KVIDENGTN------- 117
                :|.|..|....|...|            |....|..:        |....||::       
  Fly   257 SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRR 321

 Worm   118 -RTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKEKAFLAR 181
             ||.||:.||.|||:|||..||::.|.|::||::|||.|.||||||||||.|.|   :.||.|..
  Fly   322 RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK---RVKAGLTS 383

 Worm   182 NTWESNSPTS 191
            :....|..||
  Fly   384 HGLGRNGTTS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 28/45 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.