DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and ap

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:218 Identity:50/218 - (22%)
Similarity:77/218 - (35%) Gaps:59/218 - (27%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MSSTECYGA---PPHNYYQDWPTTHSYYPSVPSSYSPLNHHPADIWAAHPSNYIMGNGHVSPPA- 61
            ||:|..|.|   .|||   |..:.||                      .||..|:..|...|.: 
  Fly   277 MSATYPYSAQFGSPHN---DSSSPHS----------------------DPSRSIVPTGIFVPASH 316

 Worm    62 TASGLSPPASRSSNSSAELPTGVTASQHN-----TY----KWMHTKRSQRPAAPKKKVIDENGTN 117
            ..:||..||.:........|..:.|...|     .|    :..|...|.|    .|::       
  Fly   317 VINGLPQPARQKGRPRKRKPKDIEAFTANIDLNTEYVDFGRGSHLSSSSR----TKRM------- 370

 Worm   118 RTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKR---------- 172
            ||:|..|||..::..|......:.....:::....|.:..:::||||.|.|.::.          
  Fly   371 RTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDGSGLL 435

 Worm   173 EKEKAFLARNTWESNSPTSSCSG 195
            ||.:..|..::...:||||...|
  Fly   436 EKGEGALDLDSISVHSPTSFILG 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 10/45 (22%)
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeobox 371..424 CDD:395001 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.