DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and bsh

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster


Alignment Length:277 Identity:67/277 - (24%)
Similarity:93/277 - (33%) Gaps:110/277 - (39%)


- Green bases have known domain annotations that are detailed below.


 Worm    11 PHNYYQDWPTTHSYYP-----------------------------------SVPSSYSPLNHHPA 40
            ||.:    |:.||:.|                                   |.|.|    |||  
  Fly    98 PHKH----PSQHSHPPQSHPPASASASATATARSNQAASGYAGEDYGKSMHSTPRS----NHH-- 152

 Worm    41 DIWAAHPSNYI--------MGNG---HVSPPATASGLSPPASRSSNSSA---------------- 78
               :.|.:::.        :|:|   |...|.|.....||...:..|.|                
  Fly   153 ---SRHGTSHYNGDQISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGF 214

 Worm    79 -ELPTGVTASQHNTYK----WMHTKRSQRPAAP---KKKVIDE------NGTN----------RT 119
             ::..|..:....|||    :..::.|....||   ....:.|      .|.|          ||
  Fly   215 LQMTLGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKART 279

 Worm   120 NFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKK--REKEKAFLARN 182
            .|:..||:.|||.|...:|::...|.|:|:.|.|.|.|||.||||||||.||  |.::.|     
  Fly   280 VFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNA----- 339

 Worm   183 TWESNSPTSSCSGEDVK 199
                |.|......|..|
  Fly   340 ----NEPVDFSRSEPGK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 21/45 (47%)
bshNP_477350.2 Homeobox 278..330 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.