DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and scro

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:229 Identity:62/229 - (27%)
Similarity:91/229 - (39%) Gaps:48/229 - (20%)


- Green bases have known domain annotations that are detailed below.


 Worm     5 ECYGAPPHNYYQDWPTTHSYYPSV--------PSSYSPLNHHPADIWAAHPSNYIMGNGHVSP-- 59
            |..|.||..:..:..::....|..        |.:...|.|.|.......|::.:...||.:.  
  Fly   133 ELNGNPPSPFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMR 197

 Worm    60 ------PATASGLSPPASRSSNSSAELPTGVTASQHN-----TYKWMHTKRSQRPAAPKKKVIDE 113
                  .:||:......||..:|||   :|..:...|     ......:|..|.|.|.::|    
  Fly   198 NSASWYGSTANDPRFAISRLMSSSA---SGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRK---- 255

 Worm   114 NGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKEKAF 178
               .|..||..|:.|||:.|...:|::...|..:||.:.|...||||||||.|.|.|::.||||.
  Fly   256 ---RRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAM 317

 Worm   179 LARNTWESNSPTSS---------------CSGED 197
            ..:|  :.|.|.||               |||.:
  Fly   318 AEQN--QHNQPASSPRRVAVPVLVKDGKPCSGNN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 19/45 (42%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.