Sequence 1: | NP_498655.1 | Gene: | ceh-13 / 176069 | WormBaseID: | WBGene00000437 | Length: | 202 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001015473.1 | Gene: | scro / 3355151 | FlyBaseID: | FBgn0287186 | Length: | 468 | Species: | Drosophila melanogaster |
Alignment Length: | 229 | Identity: | 62/229 - (27%) |
---|---|---|---|
Similarity: | 91/229 - (39%) | Gaps: | 48/229 - (20%) |
- Green bases have known domain annotations that are detailed below.
Worm 5 ECYGAPPHNYYQDWPTTHSYYPSV--------PSSYSPLNHHPADIWAAHPSNYIMGNGHVSP-- 59
Worm 60 ------PATASGLSPPASRSSNSSAELPTGVTASQHN-----TYKWMHTKRSQRPAAPKKKVIDE 113
Worm 114 NGTNRTNFTTHQLTELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREKEKAF 178
Worm 179 LARNTWESNSPTSS---------------CSGED 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ceh-13 | NP_498655.1 | Homeobox | 118..164 | CDD:278475 | 19/45 (42%) |
scro | NP_001015473.1 | Homeobox | 256..309 | CDD:278475 | 23/52 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |